3.88 Rating by CuteStat

dildanismani.com is 4 years 4 months old. It is a domain having com extension. It has a global traffic rank of #10637232 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, dildanismani.com is SAFE to browse.

PageSpeed Score
55
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 79
Daily Pageviews: 158

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: 17
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 387
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 10,637,232
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

94.199.200.87

Hosted Country:

Türkiye TR

Location Latitude:

41.0484

Location Longitude:

29.0156
İngilizce Dil Danışmanı – İngilizce Özel Ders | Kartal

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 8
H3 Headings: 7 H4 Headings: Not Applicable
H5 Headings: 10 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 34
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 94.199.200.87)

Amargi Dergi | 3 aylık Feminist Dergi

- amargidergi.com
9,446,032 $ 240.00

Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları

- kayserievdenevenakliyatfirmalari.com

Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.

8,137,110 $ 240.00

Index of /

- mersindoguakdeniztemsilciligi.com
Not Applicable $ 8.95

vBulletin 4.2.0 Install System

- audiclubtr.com
Not Applicable $ 8.95

Özcanlar Mermer Granit | Yapı Malzemeleri

- ozcanlarmermergranit.com

Özcanlar Mermer Granit, güler yüzlü hizmet, güven ve kalitenin adresi

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Connection: Keep-Alive
X-Powered-By: PHP/5.6.40
Content-Type: text/html; charset=UTF-8
Link: <https://dildanismani.com/index.php/wp-json/>; rel="https://api.w.org/"
Etag: "425-1579179990;gz"
X-LiteSpeed-Cache: hit
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Mon, 20 Jan 2020 10:57:02 GMT
Alt-Svc: quic=":443"; ma=2592000; v="39,43,46", h3-Q039=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-23=":443"; ma=2592000, h3-24=":443"; ma=2592000

Domain Information

Domain Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registration Date: Jan 1, 2020, 3:09 AM 4 years 4 months 1 week ago
Expiration Date: Jan 1, 2021, 3:09 AM 3 years 4 months 2 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
cpns1.turhost.com 37.230.110.110 Türkiye Türkiye
cpns2.turhost.com 37.230.111.111 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
dildanismani.com A 10799 IP: 94.199.200.87
dildanismani.com NS 86400 Target: cpns1.turdns.com
dildanismani.com NS 86400 Target: cpns2.turdns.com
dildanismani.com SOA 10800 MNAME: cpns1.turdns.com
RNAME: csf.ofis.net
Serial: 2019121205
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
dildanismani.com MX 14400 Target: dildanismani.com
dildanismani.com TXT 14400 TXT: v=spf1 +a +mx +ip4:94.199.200.85
+ip4:94.199.200.87 +ip4:109.232.216.54
+ip4:109.232.217.54
+include:_spf.turhost.com -all

Similarly Ranked Websites

Samsun Emlak Ara – Samsun'daki Emlak Danışmanınız

- samsunemlakara.com
10,637,238 $ 8.95

Home - HelpPing

- helppingapp.com
10,637,242 $ 8.95

Murakaza neza » ityazo.rw

- ityazo.com

ityazo.rw

10,637,250 $ 8.95

Untitled Page

- whaber.com
10,637,267 $ 8.95

UAE Indian Escorts +971558798432 Indian Escorts in Dubai Provider

- uaeindianescorts.com

Call +971558798432 Escorts Edge Organize Perfect Date with Indian Escorts in Dubai, Russian, Turkish, Student Escorts in Dubai 100% Original Group of Escorts in Dubai for Sex.

10,637,274 $ 8.95

Full WHOIS Lookup

Domain Name: DILDANISMANI.COM
Registry Domain ID: 2474565784_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.aerotek.com.tr
Registrar URL:
Updated Date: 2019-12-31T21:24:50Z
Creation Date: 2019-12-31T21:24:49Z
Registrar Registration Expiration Date: 2020-12-31T21:24:49Z
Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registrar IANA ID: 1534
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Domain Admin
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant Street: 10 Corporate Drive
Registrant City: Burlington
Registrant State/Province: MA
Registrant Postal Code: 01803
Registrant Country: US
Registrant Phone: +1.8022274003
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@privacyprotect.org
Registry Admin ID: Not Available From Registry
Admin Name: Domain Admin
Admin Organization: Privacy Protect, LLC (PrivacyProtect.org)
Admin Street: 10 Corporate Drive
Admin City: Burlington
Admin State/Province: MA
Admin Postal Code: 01803
Admin Country: US
Admin Phone: +1.8022274003
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@privacyprotect.org
Registry Tech ID: Not Available From Registry
Tech Name: Domain Admin
Tech Organization: Privacy Protect, LLC (PrivacyProtect.org)
Tech Street: 10 Corporate Drive
Tech City: Burlington
Tech State/Province: MA
Tech Postal Code: 01803
Tech Country: US
Tech Phone: +1.8022274003
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@privacyprotect.org
Name Server: cpns1.turhost.com
Name Server: cpns2.turhost.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: logicbox@aerotek.com.tr
Registrar Abuse Contact Phone: +90.2623245555
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-01-20T10:57:22Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: AEROTEK

PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to
protect the owner from spam and phishing attacks. PrivacyProtect.org is not
responsible for any of the activities associated with this domain name. If you wish
to report any abuse concerning the usage of this domain name, you may do so at
http://privacyprotect.org/contact. We have a stringent abuse policy and any
complaint will be actioned within a short period of time.

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is Aerotek Bilisim Sanayi ve Ticaret AS.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.